PTHrP-(1-21)/PTH-(22-34) (human)
SMILES | None |
InChIKey | XAFMSRGNPGABMT-AXOOKYBDSA-N |
Sequence | AVSEHQLLHDKGKSIQDLRRREWLRKKLQDVHNF |
Chemical properties
Hydrogen bond acceptors | None |
Hydrogen bond donors | None |
Rotatable bonds | None |
Molecular weight (Da) |
Drug properties
Molecular type | Peptide |
Endogenous/Surrogate | Surrogate |
Approved drug | No |
Database connections
Bioactivities
Receptor | Activity | Source | |||||||
---|---|---|---|---|---|---|---|---|---|
GTP | Uniprot | Species | Family | Class | Type | Min | Avg | Max | Database |
Receptor | Activity | Source | |||||||
---|---|---|---|---|---|---|---|---|---|
GTP | Uniprot | Species | Family | Class | Type | Min | Avg | Max | Database |
PTH1 | PTH1R | Human | Parathyroid hormone | B1 | pIC50 | 7.7 | 7.7 | 7.7 | Guide to Pharmacology |
PTH2 | PTH2R | Human | Parathyroid hormone | B1 | pIC50 | 7.0 | 7.5 | 8.0 | Guide to Pharmacology |
PTH2 | PTH2R | Rat | Parathyroid hormone | B1 | pIC50 | 5.5 | 5.5 | 5.5 | Guide to Pharmacology |